PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR12G08270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family M-type_MADS
Protein Properties Length: 202aa    MW: 21286.2 Da    PI: 9.9515
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR12G08270.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF57.12.3e-181960243
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                     +ie ks rqvtfskRr+g++KKA+EL vL++a+va  +fs+ 
  LPERR12G08270.1 19 PIEKKSPRQVTFSKRRKGMFKKASELAVLTGARVAAAVFSQA 60
                     599************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006620.9131070IPR002100Transcription factor, MADS-box
SMARTSM004321.6E-201069IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.71E-211180IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-131232IPR002100Transcription factor, MADS-box
PfamPF003193.2E-192064IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-133247IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-134768IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MAPAEKRQSK GKQKIDICPI EKKSPRQVTF SKRRKGMFKK ASELAVLTGA RVAAAVFSQA  60
ENAFLFGDPS IDAVLRSYAP AGAAAVAPLV AGHGNGGDGL FGGEEGGGGG DVGFDPEAMR  120
RAEEETKAQV AAEQARMRGA AARILALAGG RPWWEADVEA LGEAELPEFV RAVEKLRATV  180
GRLANDTPLA ADPPPPQQQK RR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006656125.11e-56PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLA0A0D9XYR91e-141A0A0D9XYR9_9ORYZ; Uncharacterized protein
STRINGOB06G24150.11e-55(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28333088
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.14e-21AGAMOUS-like 61